RHAMM/CD168 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23845925UL

Catalog No. NB396818

Description

RHAMM/CD168 Polyclonal specifically detects RHAMM/CD168 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RHAMM/CD168
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: O75330
• Gene Symbols: HMMR
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD168, CD168 antigen, hyaluronan mediated motility receptor, hyaluronan-mediated motility receptor (RHAMM), IHABP, Intracellular hyaluronic acid-binding protein, MGC119494, Receptor for hyaluronan-mediated motility, RHAMMMGC119495
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3161
• Target Species: Human
• Isotype: IgG