RHBDF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159725

Catalog No. NBP159725

Description

RHBDF1 Polyclonal specifically detects RHBDF1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RHBDF1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C16orf8, chromosome 16 open reading frame 8, Dist1, EGFR-RS, epidermal growth factor receptor, related sequence, FLJ2235, FLJ22357, gene-89, gene-90, hDist1, p100hRho, Rhomboid 5 homolog 1, rhomboid 5 homolog 1 (Drosophila), rhomboid family 1, rhomboid family 1 (Drosophila), rhomboid family member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 97 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96CC6
• Gene Symbols: RHBDF1
• Immunogen: Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64285
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only