RHCG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23090525UL

Catalog No. NB437356

Description

RHCG Polyclonal specifically detects RHCG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RHCG
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9UBD6
• Gene Symbols: RHCG
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RYDFEADAHWWSERTHKNLSDMENEFYYRYP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ammonium transporter Rh type C, CDRC2, chromosome 15 open reading frame 6, PDRC2C15orf6, Rh family type C glycoprotein, Rh family, C glycoprotein, Rh glycoprotein kidney, Rh type C glycoprotein, Rhesus blood group family type C glycoprotein, Rhesus blood group, C glycoprotein, RHGKTumor-related protein DRC2, SLC42A3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51458
• Target Species: Human
• Isotype: IgG

For Research Use Only