RhoC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23865125UL

Catalog No. NB436141

Description

RhoC Polyclonal specifically detects RhoC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RhoC
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ARH9ARHCRho cDNA clone 9, H9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RHOC
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 389
• Target Species: Human
• Isotype: IgG