RhoC Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP158351	100 μL

Catalog No. NBP158351 Supplier Novus Biologicals Supplier No. NBP158351

Description

Rabbit Polyclonal Antibody

RhoC Polyclonal specifically detects RhoC in Human, Invertebrate samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RhoC
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P08134
• Gene Alias: ARH9ARHCRho cDNA clone 9, H9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC
• Gene Symbols: RHOC
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to RHOC (ras homolog gene family, member C). The peptide sequence was selected from the N terminal of RHOC. Peptide sequence: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 389
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Invertebrate, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Yeast, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only