Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RhoF Antibody, Novus Biologicals™
SDP

Catalog No. NBP1551620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1551620 20 μL
NBP155116 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1551620 Supplier Novus Biologicals Supplier No. NBP15511620UL

Rabbit Polyclonal Antibody

RhoF Polyclonal specifically detects RhoF in Human samples. It is validated for Western Blot.

Specifications

Antigen RhoF
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9HBH0
Gene Alias FLJ20247, ras homolog gene family, member F (in filopodia), Rho family GTPase Rif, Rho in filopodia, rho-related GTP-binding protein RhoF, RIFARHF
Gene Symbols RHOF
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RHOF(ras homolog gene family, member F (in filopodia)) The peptide sequence was selected from the middle region of RHOF. Peptide sequence DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM.
Molecular Weight of Antigen 23 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54509
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.