Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RHOXF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310524100UL
Description
RHOXF1 Polyclonal specifically detects RHOXF1 in Human samples. It is validated for Western Blot.Specifications
RHOXF1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MGC119030, OTEXMGC119033, Ovary-, testis- and epididymis-expressed gene protein, Paired-like homeobox protein PEPP-1, PEPP subfamily gene 1, PEPP1paired-like homeobox protein OTEX, rhox homeobox family member 1, Rhox homeobox family, member 1 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOXF1 (NP_644811). Peptide sequence ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM | |
100 μg | |
Signal Transduction | |
158800 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction