Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RHOXF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RHOXF1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
RHOXF1 Polyclonal specifically detects RHOXF1 in Human samples. It is validated for Western Blot.Specifications
RHOXF1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS buffer, 2% sucrose | |
158800 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
MGC119030, OTEXMGC119033, Ovary-, testis- and epididymis-expressed gene protein, Paired-like homeobox protein PEPP-1, PEPP subfamily gene 1, PEPP1paired-like homeobox protein OTEX, rhox homeobox family member 1, Rhox homeobox family, member 1 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human RHOXF1 (NP_644811). Peptide sequence ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title