RICS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192334

Catalog No. NBP192334

Description

RICS Polyclonal specifically detects RICS in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RICS
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: brain-specific Rho GTP-ase-activating protein, Brain-specific Rho GTPase-activating protein, GAB-associated CDC42, GAB-associated Cdc42/Rac GTPase-activating protein, GC-GAPGTPase regulator interacting with TrkA, GRITp200RhoGAP, KIAA0712p250GAP, MGC1892, rac GTPase activating protein, Rho GTPase activating protein 32, rho GTPase-activating protein 32, Rho/Cdc42/Rac GTPase-activating protein RICS, RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling, RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling, Rho-type GTPase-activating protein 32, RICSPX-RICS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9743
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ARHGAP32
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only