RIMS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256512

Catalog No. NBP256512

Description

RIMS2 Polyclonal specifically detects RIMS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RIMS2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3IP3, regulating synaptic membrane exocytosis 2, regulating synaptic membrane exocytosis protein 2, RIM 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9699
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RIMS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only