Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RIMS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RIMS2 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RIMS2 Polyclonal specifically detects RIMS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RIMS2 | |
Polyclonal | |
Rabbit | |
Human | |
DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3IP3, regulating synaptic membrane exocytosis 2, regulating synaptic membrane exocytosis protein 2, RIM 2 | |
RIMS2 | |
IgG | |
Affinity Purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9699 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title