RIPK4 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156504	100 μL

Catalog No. NBP156504 Supplier Novus Biologicals Supplier No. NBP156504

Description

Rabbit Polyclonal Antibody

RIPK4 Polyclonal specifically detects RIPK4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RIPK4
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9H4D1
• Gene Alias: ANKK2, ANKRD3MGC129993, ankyrin repeat domain 3, Ankyrin repeat domain-containing protein 3, DIKMGC129992, EC 2.7.11, EC 2.7.11.1, PKC-delta-interacting protein kinase, PKK, receptor-interacting serine/threonine-protein kinase 4, receptor-interacting serine-threonine kinase 4, RIP4, serine/threonine-protein kinase ANKRD3
• Gene Symbols: RIPK4
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to RIPK4(receptor-interacting serine-threonine kinase 4) The peptide sequence was selected from the middle region of RIPK4. Peptide sequence GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT.
• Molecular Weight of Antigen: 86 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Protein Kinase
• Primary or Secondary: Primary
• Gene ID (Entrez): 54101
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only