Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Rit1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24907525UL
Description
Rit1 Polyclonal antibody specifically detects Rit1 in Human samples. It is validated for Western BlotSpecifications
Rit1 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL | |
GTP-binding protein Rit1, GTP-binding protein Roc1, MGC125864, MGC125865, Ras-like protein expressed in many tissues, Ras-like without CAAX 1, Ras-like without CAAX protein 1, RIBBRIT, Ric-like, expressed in many tissues, RIT, ROC1Ric (Drosophila)-like, expressed in many tissues | |
This antibody was developed against a recombinant protein corresponding to amino acids: AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT | |
25 μL | |
Signal Transduction, Vision | |
6016 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction