Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Rit1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | Rit1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Rit1 Polyclonal antibody specifically detects Rit1 in Human samples. It is validated for Western BlotSpecifications
| Rit1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction, Vision | |
| PBS (pH 7.2), 40% Glycerol | |
| 6016 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| GTP-binding protein Rit1, GTP-binding protein Roc1, MGC125864, MGC125865, Ras-like protein expressed in many tissues, Ras-like without CAAX 1, Ras-like without CAAX protein 1, RIBBRIT, Ric-like, expressed in many tissues, RIT, ROC1Ric (Drosophila)-like, expressed in many tissues | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title