RNA Helicase A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25688925UL

Catalog No. NB394250

Description

RNA Helicase A Polyclonal antibody specifically detects RNA Helicase A in Human samples. It is validated for Western Blot

Specifications

• Antigen: RNA Helicase A
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL
• Gene Alias: DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, EC 3.6.1, EC 3.6.1.15, EC 3.6.4.13, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ
• Quantity: 25 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 1660
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified