Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNA Polymerase II/POLR2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25566325UL
Description
RNA Polymerase II/POLR2A Polyclonal specifically detects RNA Polymerase II/POLR2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RNA Polymerase II/POLR2A | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kdsubunit, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase III largest subunit, EC 2.7.7.48, EC 2.7.7.6, hRPB220, hsRPB1, MGC75453, POLR2, POLRA, polymerase (RNA) II (DNA directed) polypeptide A (220kD), polymerase (RNA) II (DNA directed) polypeptide A, 220kDa, RNA Pol 2, RNA Polymerase 2, RNA polymerase II subunit B1, RNA-directed RNA polymerase II subunit RPB1, RNAPII, RPB1, RPBh1, RpIILS, RPO2, RPOL2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
POLR2A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLS | |
25 μL | |
Chromatin Research, Epigenetics, microRNA, Transcription Factors and Regulators | |
5430 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction