RNA Polymerase II/POLR2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255663	Novus Biologicals NBP255663	100 μL
NB394888	Novus Biologicals NBP25566325UL	25 μL

Description

RNA Polymerase II/POLR2A Polyclonal specifically detects RNA Polymerase II/POLR2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RNA Polymerase II/POLR2A
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Chromatin Research, Epigenetics, microRNA, Transcription Factors and Regulators
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5430
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLS
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kdsubunit, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase III largest subunit, EC 2.7.7.48, EC 2.7.7.6, hRPB220, hsRPB1, MGC75453, POLR2, POLRA, polymerase (RNA) II (DNA directed) polypeptide A (220kD), polymerase (RNA) II (DNA directed) polypeptide A, 220kDa, RNA Pol 2, RNA Polymerase 2, RNA polymerase II subunit B1, RNA-directed RNA polymerase II subunit RPB1, RNAPII, RPB1, RPBh1, RpIILS, RPO2, RPOL2
• Gene Symbols: POLR2A
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only