Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RNase H1 Antibody, Novus Biologicals™

RNase H1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238501 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238501 0.1 mL
NB436188 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238501 Supplier Novus Biologicals Supplier No. NBP238501
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

RNase H1 Polyclonal specifically detects RNase H1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Proximity Ligation Assay.

Specifications

Antigen RNase H1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), In situ PLA, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Proximity Ligation Assay
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O60930
Gene Alias EC 3.1.26.4, H1RNA, Ribonuclease H type II, ribonuclease H1, RNase H1, RNH1
Gene Symbols RNASEH1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 246243
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.