Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNASEH2A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15823520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15823520 20 μL
NBP158235 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15823520 Supplier Novus Biologicals Supplier No. NBP15823520UL

Rabbit Polyclonal Antibody

RNASEH2A Polyclonal specifically detects RNASEH2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RNASEH2A
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O75792
Gene Alias AGS4RNase H2 subunit A, Aicardi-Goutieres syndrome 4, Aicardi-Goutieres syndrome 4 protein, JUNB, ribonuclease H2 subunit A, ribonuclease H2, large subunit, ribonuclease H2, subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A, ribonuclease HI, large subunit, RNase H(35), RNASEHIEC 3.1.26.4, RNHIARNase HI large subunit, RNHL
Gene Symbols RNASEH2A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10535
Test Specificity This product is specific to Subunit or Isoform: A.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.