RNASEH2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15823520UL

Catalog No. NBP15823520

Description

RNASEH2A Polyclonal specifically detects RNASEH2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNASEH2A
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O75792
• Gene Symbols: RNASEH2A
• Immunogen: Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: A.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AGS4RNase H2 subunit A, Aicardi-Goutieres syndrome 4, Aicardi-Goutieres syndrome 4 protein, JUNB, ribonuclease H2 subunit A, ribonuclease H2, large subunit, ribonuclease H2, subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A, ribonuclease HI, large subunit, RNase H(35), RNASEHIEC 3.1.26.4, RNHIARNase HI large subunit, RNHL
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10535
• Target Species: Human
• Form: Purified