Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNASEH2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	RNASEH2A
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15823520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15823520UL	20 μL	Each for $206.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP158235 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP158235	100 μL	Each for $499.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

RNASEH2A Polyclonal specifically detects RNASEH2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	RNASEH2A
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	AGS4RNase H2 subunit A, Aicardi-Goutieres syndrome 4, Aicardi-Goutieres syndrome 4 protein, JUNB, ribonuclease H2 subunit A, ribonuclease H2, large subunit, ribonuclease H2, subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A, ribonuclease HI, large subunit, RNase H(35), RNASEHIEC 3.1.26.4, RNHIARNase HI large subunit, RNHL
Gene Symbols	RNASEH2A
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	O75792
Gene ID (Entrez)	10535
Immunogen	Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE.
Primary or Secondary	Primary
Test Specificity	This product is specific to Subunit or Isoform: A.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNASEH2A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents