Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASET2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | RNASET2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18001720
|
Novus Biologicals
NBP18001720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP180017
|
Novus Biologicals
NBP180017 |
100 μL |
Each for $499.50
|
|
|||||
Description
RNASET2 Polyclonal specifically detects RNASET2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| RNASET2 | |
| Unconjugated | |
| RUO | |
| EC 3.1.27.-, EC 3.1.27.1, FLJ10907, FLJ42372, Ribonuclease 6, ribonuclease T2, RNASE6PLbA514O12.3 | |
| RNASET2 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| NP_003721 | |
| 8635 | |
| Synthetic peptide directed towards the middle region of human RNASET2. Peptide sequence RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title