Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASET2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RNASET2 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18001720
|
Novus Biologicals
NBP18001720UL |
20 μL |
Each for $152.22
|
|
NBP180017
|
Novus Biologicals
NBP180017 |
100 μL |
Each for $436.00
|
|
Description
RNASET2 Polyclonal specifically detects RNASET2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
RNASET2 | |
Unconjugated | |
RUO | |
EC 3.1.27.-, EC 3.1.27.1, FLJ10907, FLJ42372, Ribonuclease 6, ribonuclease T2, RNASE6PLbA514O12.3 | |
RNASET2 | |
IgG | |
Affinity Purified |
Polyclonal | |
Rabbit | |
NP_003721 | |
8635 | |
Synthetic peptide directed towards the middle region of human RNASET2. Peptide sequence RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title