Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RNF113A Antibody, Novus Biologicals™

RNF113A Antibody, Novus Biologicals™
SDP

Catalog No. NBP18031820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18031820 20 μL
NBP180318 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18031820 Supplier Novus Biologicals Supplier No. NBP18031820UL

Description

Rabbit Polyclonal Antibody

RNF113A Polyclonal specifically detects RNF113A in Human samples. It is validated for Western Blot.

Specifications

Antigen RNF113A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_008909
Gene Alias ring finger protein 113A, RNF113Cwc24, Zinc finger protein 183, zinc finger protein 183 (RING finger, C3HC4 type), ZNF183
Gene Symbols RNF113A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human RNF113A. Peptide sequence LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 7737
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.