Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF113A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RNF113A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18031820 View Documents View Product Certificates	Novus Biologicals NBP18031820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180318 View Documents View Product Certificates	Novus Biologicals NBP180318	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RNF113A Polyclonal specifically detects RNF113A in Human samples. It is validated for Western Blot.

Specifications

Antigen	RNF113A
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Gene Alias	ring finger protein 113A, RNF113Cwc24, Zinc finger protein 183, zinc finger protein 183 (RING finger, C3HC4 type), ZNF183
Gene Symbols	RNF113A
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_008909
Gene ID (Entrez)	7737
Immunogen	Synthetic peptide directed towards the middle region of human RNF113A. Peptide sequence LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNF113A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents