RNF133 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162487

Catalog No. NBP162487

Description

RNF133 Polyclonal specifically detects RNF133 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF133
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 168433
• Target Species: Human, Mouse, Rat, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WVZ7
• Gene Symbols: RNF133
• Immunogen: Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.