RNF144A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21323825UL

Catalog No. NB438642

Description

RNF144A Polyclonal specifically detects RNF144A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNF144A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: EC 6.3.2, EC 6.3.2.-, KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A, ring finger protein 144Aring finger protein 144, RNF144, UbcM4-interacting protein 4, ubiquitin conjugating enzyme 7 interacting protein 4, Ubiquitin-conjugating enzyme 7-interacting protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RNF144A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
• Quantity: 25ul
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 9781
• Target Species: Human
• Isotype: IgG

For Research Use Only