Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF175 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF175 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
RNF175 Polyclonal specifically detects RNF175 in Human samples. It is validated for Western Blot.Specifications
RNF175 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
FLJ34190, ring finger protein 175 | |
RNF175 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Zinc Finger | |
Q8NB61 | |
285533 | |
Synthetic peptides corresponding to RNF175(ring finger protein 175) The peptide sequence was selected from the middle region of RNF175. Peptide sequence YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII. | |
Primary | |
19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title