Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF185 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15976120UL
Description
RNF185 Polyclonal specifically detects RNF185 in Human samples. It is validated for Western Blot.Specifications
RNF185 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96GF1 | |
RNF185 | |
Synthetic peptides corresponding to RNF185(ring finger protein 185) The peptide sequence was selected from the middle region of RNF185. Peptide sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF. | |
20 μL | |
Zinc Finger | |
91445 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
BSK65-MONO1, BSK65-MONO2, BSK65-PANC1, BSK65-PANC2, BSK65-TEST1, BSK65-TEST2, BSK65-TEST3, FLJ38628, ring finger protein 185 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction