Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP25641325UL
Description
RNF34 Polyclonal specifically detects RNF34 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.Specifications
RNF34 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunoprecipitation | |
CARP1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34, EC 6.3.2, EC 6.3.2.-, FLJ21786, FYVE-RING finger protein Momo, hRFI, Human RING finger homologous to inhibitor of apoptosis protein, RFI, RIF, RIFF, ring finger protein 34°CARP-1, RING finger protein RIFF | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
RNF34 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL | |
25 μL | |
Apoptosis | |
80196 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction