Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15310820UL
Description
RNF38 Polyclonal specifically detects RNF38 in Human samples. It is validated for Western Blot.Specifications
RNF38 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
FLJ21343, ring finger protein 38 | |
Rabbit | |
Protein A purified | |
RUO | |
152006 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
RNF38 | |
Synthetic peptides corresponding to RNF38(ring finger protein 38) The peptide sequence was selected from the N terminal of RNF38. Peptide sequence FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP. | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction