Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	RNF38
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15310820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15310820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP153108 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP153108	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RNF38 Polyclonal specifically detects RNF38 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RNF38
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene ID (Entrez)	152006
Immunogen	Synthetic peptides corresponding to RNF38(ring finger protein 38) The peptide sequence was selected from the N terminal of RNF38. Peptide sequence FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Alias	FLJ21343, ring finger protein 38
Gene Symbols	RNF38
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNF38 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents