RNF40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18835625UL

Catalog No. NB418147

Description

RNF40 Polyclonal specifically detects RNF40 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNF40
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 95 kDa retinoblastoma-associated protein, BRE1-B, BRE1BMGC13051, EC 6.3.2,95 kDa retinoblastoma protein binding protein, EC 6.3.2.-, KIAA0661BRE1 E3 ubiquitin ligase homolog B, Rb-associated protein, RBP95E3 ubiquitin-protein ligase BRE1B, ring finger protein 40DKFZp686K191, STARING
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RNF40
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
• Quantity: 25 μL
• Research Discipline: Chromatin Research, Vision, Zinc Finger
• Gene ID (Entrez): 9810
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only