Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF6 Antibody, Novus Biologicals™
SDP

Catalog No. NB8025120UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB8025120UL 20 μL
NBP180251 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB8025120UL Supplier Novus Biologicals Supplier No. NBP18025120UL

Rabbit Polyclonal Antibody

RNF6 Polyclonal specifically detects RNF6 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RNF6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_083050
Gene Alias DKFZp686P0776, E3 ubiquitin-protein ligase RNF6, EC 6.3.2.-, ring finger protein (C3H2C3 type) 6, RING-H2 protein RNF-6, SPG2
Gene Symbols RNF6
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of mouse RNF6. Peptide sequence MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM.
Molecular Weight of Antigen 73 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6049
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.