RNF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180251

Catalog No. NBP180251

Description

RNF6 Polyclonal specifically detects RNF6 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNF6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686P0776, E3 ubiquitin-protein ligase RNF6, EC 6.3.2.-, ring finger protein (C3H2C3 type) 6, RING-H2 protein RNF-6, SPG2
• Host Species: Rabbit
• Molecular Weight of Antigen: 73 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_083050
• Gene Symbols: RNF6
• Immunogen: Synthetic peptide directed towards the N terminal of mouse RNF6. Peptide sequence MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6049
• Target Species: Mouse, Rat
• Form: Purified