Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180251
Description
RNF6 Polyclonal specifically detects RNF6 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RNF6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686P0776, E3 ubiquitin-protein ligase RNF6, EC 6.3.2.-, ring finger protein (C3H2C3 type) 6, RING-H2 protein RNF-6, SPG2 | |
Rabbit | |
73 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
NP_083050 | |
RNF6 | |
Synthetic peptide directed towards the N terminal of mouse RNF6. Peptide sequence MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM. | |
Protein A purified | |
RUO | |
6049 | |
Mouse, Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction