RNPC1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP157503	100 μL

Catalog No. NBP157503 Supplier Novus Biologicals Supplier No. NBP157503

Description

Rabbit Polyclonal Antibody

RNPC1 Polyclonal specifically detects RNPC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNPC1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9H0Z9
• Gene Alias: CLL-associated antigen KW-5, HSRNASEBRRM) containing 1, RNA binding motif protein 38, RNA-binding motif protein 38, RNA-binding protein 38, RNA-binding region containing protein 1, RNA-binding region-containing protein 1, SEB4, seb4B, ssDNA binding protein SEB4, ssDNA-binding protein SEB4
• Gene Symbols: RBM38
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to RBM38(RNA binding motif protein 38) The peptide sequence was selected from the middle region of RBM38. Peptide sequence QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55544
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 85%; Pig: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only