RNPC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157503

Catalog No. NBP157503

Description

RNPC1 Polyclonal specifically detects RNPC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNPC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CLL-associated antigen KW-5, HSRNASEBRRM) containing 1, RNA binding motif protein 38, RNA-binding motif protein 38, RNA-binding protein 38, RNA-binding region containing protein 1, RNA-binding region-containing protein 1, SEB4, seb4B, ssDNA binding protein SEB4, ssDNA-binding protein SEB4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55544
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H0Z9
• Gene Symbols: RBM38
• Immunogen: Synthetic peptides corresponding to RBM38(RNA binding motif protein 38) The peptide sequence was selected from the middle region of RBM38. Peptide sequence QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 85%; Pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG

For Research Use Only