Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNPC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25710025UL
Description
RNPC3 Polyclonal specifically detects RNPC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RNPC3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
FLJ20008, FLJ25070, KIAA183, KIAA1839, RBM40U11/U12 snRNP 65 kDa protein, RNA recognition protein, RNA-binding motif protein 40, RNA-binding protein 40, RNA-binding region (RNP1, RRM) containing 3, RNA-binding region-containing protein 3, RNP, U11/U12 small nuclear ribonucleoprotein 65 kDa protein, U11/U12 snRNP 65K, U11/U12-65K | |
Rabbit | |
Affinity Purified | |
RUO | |
55599 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
RNPC3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction