RNPC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257100

Catalog No. NBP257100

Description

RNPC3 Polyclonal specifically detects RNPC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RNPC3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FLJ20008, FLJ25070, KIAA183, KIAA1839, RBM40U11/U12 snRNP 65 kDa protein, RNA recognition protein, RNA-binding motif protein 40, RNA-binding protein 40, RNA-binding region (RNP1, RRM) containing 3, RNA-binding region-containing protein 3, RNP, U11/U12 small nuclear ribonucleoprotein 65 kDa protein, U11/U12 snRNP 65K, U11/U12-65K
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55599
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RNPC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only