Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNPC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNPC3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNPC3 Polyclonal specifically detects RNPC3 in Human samples. It is validated for Western Blot.Specifications
RNPC3 | |
Polyclonal | |
Rabbit | |
Q96LT9 | |
55599 | |
Synthetic peptides corresponding to RNPC3(RNA-binding region (RNP1, RRM) containing 3) The peptide sequence was selected from the middle region of RNPC3. Peptide sequence LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ20008, FLJ25070, KIAA183, KIAA1839, RBM40U11/U12 snRNP 65 kDa protein, RNA recognition protein, RNA-binding motif protein 40, RNA-binding protein 40, RNA-binding region (RNP1, RRM) containing 3, RNA-binding region-containing protein 3, RNP, U11/U12 small nuclear ribonucleoprotein 65 kDa protein, U11/U12 snRNP 65K, U11/U12-65K | |
RNPC3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title