RNPEPL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156882

Catalog No. NBP156882

Description

RNPEPL1 Polyclonal specifically detects RNPEPL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNPEPL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: argininyl aminopeptidase-like 1, arginyl aminopeptidase (aminopeptidase B)-like 1, arginyl aminopeptidase-like 1, EC 3.4.11.-, FLJ10806, FLJ26675, MGC99544, RNPEP-like 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57140
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HAU8
• Gene Symbols: RNPEPL1
• Immunogen: Synthetic peptides corresponding to RNPEPL1(arginyl aminopeptidase (aminopeptidase B)-like 1) The peptide sequence was selected from the N terminal of RNPEPL1. Peptide sequence LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Mouse: 100%; Pig: 100%; Canine: 92%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig
• Isotype: IgG