Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ROD1 Antibody, Novus Biologicals™

ROD1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18045320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18045320 20 μL
NBP180453 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18045320 Supplier Novus Biologicals Supplier No. NBP18045320UL

Description

Rabbit Polyclonal Antibody

ROD1 Polyclonal specifically detects ROD1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ROD1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_659153
Gene Alias DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Gene Symbols PTBP3
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human Rod1. Peptide sequence YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9991
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.