Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ROD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18045320UL
Description
ROD1 Polyclonal specifically detects ROD1 in Mouse samples. It is validated for Western Blot.Specifications
ROD1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_659153 | |
PTBP3 | |
Synthetic peptide directed towards the N terminal of human Rod1. Peptide sequence YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe) | |
Rabbit | |
Affinity Purified | |
RUO | |
9991 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction