Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ROD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ROD1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18045320 View Documents View Product Certificates	Novus Biologicals NBP18045320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180453 View Documents View Product Certificates	Novus Biologicals NBP180453	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ROD1 Polyclonal specifically detects ROD1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	ROD1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_659153
Gene ID (Entrez)	9991
Immunogen	Synthetic peptide directed towards the N terminal of human Rod1. Peptide sequence YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Gene Symbols	PTBP3
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ROD1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents