Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ ROR gamma/RORC/NR1F3 Recombinant Protein Antigen
SDP

Catalog No. NBP256610PE Shop All R&D Systems Products
Click to view available options
Quantity:
100 μL

Catalog No. NBP256610PE

Supplier: Novus Biologicals™ NBP256610PEP

Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROR gamma/RORC/NR1F3. Source: E.coli Amino Acid Sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV The ROR gamma/RORC/NR1F3 Recombinant Protein Antigen is derived from E. coli. The ROR gamma/RORC/NR1F3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 6097
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name ROR gamma/RORC/NR1F3 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias MGC129539, Nuclear receptor ROR gamma, Nuclear receptor ROR-gamma, Nuclear receptor RZR gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, RAR-Related Orphan Nuclear Receptor Variant 2, RAR-related orphan receptor C, RAR-rel
Gene Symbol RORC
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52891. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.