RPA70 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158121

Catalog No. NBP158121

Description

RPA70 Polyclonal specifically detects RPA70 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPA70
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HSSB, MST075, MSTP075, REPA1RF-A protein 1, Replication factor A protein 1, replication protein A 70 kDa DNA-binding subunit, replication protein A1 (70kD), replication protein A1, 70kDa, RF-A, RP-A, RPA70RP-A p70, Single-stranded DNA-binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P27694
• Gene Symbols: RPA1
• Immunogen: Synthetic peptides corresponding to RPA1(replication protein A1, 70kDa) The peptide sequence was selected from the middle region of RPA1 (NP_002936). Peptide sequence SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI.
• Quantity: 100 μL
• Research Discipline: DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 6117
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only