RPE65 Rabbit anti-Mouse, Rat, Clone: 5X1F6, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP316840100UL

Catalog No. NB168768

Description

RPE65 Monoclonal antibody specifically detects RPE65 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RPE65
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: 5X1F6
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: All-trans-retinyl-palmitate hydrolase, BCO family, member 3, BCO3, EC 3.1.1.64, EC:3.1.1.64, EC:5.3.3.22, LCA2, lutein isomerase, meso-zeaxanthin isomerase, mRPE65, p63, RBP-binding membrane protein, rd12, retinal pigment epithelium specific protein 65, Retinal pigment epithelium-specific 65 kDa protein, retinal pigment epithelium-specific protein 65kDa, retinitis pigmentosa 20 (autosomal recessive), retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, RPE65, retinoid isomerohydrolase, sRPE65
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human RPE65 (Q16518). TIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPA
• Quantity: 100 μg
• Research Discipline: Cellular Markers, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Sensory Systems, Signal Transduction, Vision
• Gene ID (Entrez): 6121
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG