RPE65 Rabbit anti-Mouse, Rat, Clone: 5X1F6, Novus Biologicals™

Rabbit Monoclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB168769	Novus Biologicals NBP31684020UL	20 μg
NB168768	Novus Biologicals NBP316840100UL	100 μg

Description

RPE65 Monoclonal antibody specifically detects RPE65 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RPE65
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Monoclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Mouse, Rat
• Gene Alias: All-trans-retinyl-palmitate hydrolase, BCO family, member 3, BCO3, EC 3.1.1.64, EC:3.1.1.64, EC:5.3.3.22, LCA2, lutein isomerase, meso-zeaxanthin isomerase, mRPE65, p63, RBP-binding membrane protein, rd12, retinal pigment epithelium specific protein 65, Retinal pigment epithelium-specific 65 kDa protein, retinal pigment epithelium-specific protein 65kDa, retinitis pigmentosa 20 (autosomal recessive), retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, RPE65, retinoid isomerohydrolase, sRPE65
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human RPE65 (Q16518). TIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPA
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.

• Clone: 5X1F6
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cellular Markers, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Sensory Systems, Signal Transduction, Vision
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Gene ID (Entrez): 6121
• Isotype: IgG
• Purification Method: Affinity purified