Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RPL10A Antibody, Novus Biologicals™

RPL10A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15630420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15630420 20 μL
NBP156304 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15630420 Supplier Novus Biologicals Supplier No. NBP15630420UL

Description

Rabbit Polyclonal Antibody

RPL10A Polyclonal specifically detects RPL10A in Human samples. It is validated for Western Blot.

Specifications

Antigen RPL10A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P62906
Gene Alias CSA-19, Csa-19,60S ribosomal protein L10a, NEDD6, NEDD-6, Neural precursor cell expressed developmentally down-regulated protein 6, ribosomal protein L10a
Gene Symbols RPL10A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RPL10A (ribosomal protein L10a) The peptide sequence was selected from the middle region of RPL10A)(50ug). Peptide sequence YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4736
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.