Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL13A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RPL13A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RPL13A Polyclonal specifically detects RPL13A in Human samples. It is validated for Western Blot.Specifications
RPL13A | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
60S ribosomal protein L13a, ribosomal protein L13a, tissue specific transplantation antigen 1,23 kDa highly basic protein, TSTA1 | |
RPL13A | |
IgG | |
22 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P40429 | |
23521 | |
Synthetic peptides corresponding to RPL13A(ribosomal protein L13a) The peptide sequence was selected from the middle region of RPL13A. Peptide sequence HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title