Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL24/RLP24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15547920UL
Description
RPL24/RLP24 Polyclonal specifically detects RPL24/RLP24 in Human samples. It is validated for Western Blot.Specifications
RPL24/RLP24 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9UHA3 | |
RSL24D1 | |
Synthetic peptides corresponding to C15ORF15 The peptide sequence was selected from the middle region of C15ORF15. Peptide sequence FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED. | |
Affinity Purified | |
RUO | |
51187 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3 | |
Rabbit | |
19 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction