RPL36A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP238036

Catalog No. NBP238036

Description

RPL36A Polyclonal specifically detects RPL36A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RPL36A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 60S ribosomal protein L36a, Cell growth-inhibiting gene 15 protein, Cell migration-inducing gene 6 protein, dJ164F3.3 (ribosomal protein L44), L44L, L44-like ribosomal protein, MGC72020, MIG6,60S ribosomal protein L44, ribosomal protein L36a, ribosomal protein L44, RPL36AL, RPL44
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6173
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RPL36A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MIAPTDSHEEVRSGTSYILPFASRFLSFRA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.