Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17991220UL
Description
RPL37 Polyclonal specifically detects RPL37 in Human samples. It is validated for Western Blot.Specifications
RPL37 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_000988 | |
RPL37 | |
The immunogen for this antibody is RPL37. Peptide sequence PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA. | |
Affinity Purified | |
RUO | |
6167 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686G1699, G1.16, MGC99572,60S ribosomal protein L37,60S ribosomal protein L37a, ribosomal protein L37 | |
Rabbit | |
11 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction